MPHOSPH6 monoclonal antibody (M12), clone 3G8-2F5
  • MPHOSPH6 monoclonal antibody (M12), clone 3G8-2F5

MPHOSPH6 monoclonal antibody (M12), clone 3G8-2F5

Ref: AB-H00010200-M12
MPHOSPH6 monoclonal antibody (M12), clone 3G8-2F5

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant MPHOSPH6.
Información adicional
Size 100 ug
Gene Name MPHOSPH6
Gene Alias MPP|MPP-6|MPP6
Gene Description M-phase phosphoprotein 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MAAERKTKLSKNLLRMKFMQRGLDSETKKQLEEEEKKIISEEHWYLDLPELKEKESFIIEEQSFLLCEDLLYGRMSFRGFNPEVEKLMLQMNAKHKAEEVEDETVELDVSDEEMARRYETLVGTIGKKFARKRDHANYEEDENGDITPIKAKKMFLKPQD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MPHOSPH6 (AAH05242, 1 a.a. ~ 160 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10200
Clone Number 3G8-2F5
Iso type IgG1 Kappa

Enviar un mensaje


MPHOSPH6 monoclonal antibody (M12), clone 3G8-2F5

MPHOSPH6 monoclonal antibody (M12), clone 3G8-2F5