PRMT3 monoclonal antibody (M16), clone 3G4
  • PRMT3 monoclonal antibody (M16), clone 3G4

PRMT3 monoclonal antibody (M16), clone 3G4

Ref: AB-H00010196-M16
PRMT3 monoclonal antibody (M16), clone 3G4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PRMT3.
Información adicional
Size 100 ug
Gene Name PRMT3
Gene Alias HRMT1L3
Gene Description protein arginine methyltransferase 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq LPHGKQQTPCLFCNRLFTSAEETFSHCKSEHQFNIDSMVHKHGLEFYGYIKLINFIRLKNPTVEYMNSIYNPVPWEKEEYLKPVLEDDLLLQFDVEDLY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PRMT3 (NP_005779, 41 a.a. ~ 139 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10196
Clone Number 3G4
Iso type IgG1 Kappa

Enviar un mensaje


PRMT3 monoclonal antibody (M16), clone 3G4

PRMT3 monoclonal antibody (M16), clone 3G4