HRMT1L3 polyclonal antibody (A01)
  • HRMT1L3 polyclonal antibody (A01)

HRMT1L3 polyclonal antibody (A01)

Ref: AB-H00010196-A01
HRMT1L3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant HRMT1L3.
Información adicional
Size 50 uL
Gene Name PRMT3
Gene Alias HRMT1L3
Gene Description protein arginine methyltransferase 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq LPHGKQQTPCLFCNRLFTSAEETFSHCKSEHQFNIDSMVHKHGLEFYGYIKLINFIRLKNPTVEYMNSIYNPVPWEKEEYLKPVLEDDLLLQFDVEDLY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HRMT1L3 (NP_005779, 41 a.a. ~ 139 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10196

Enviar un mensaje


HRMT1L3 polyclonal antibody (A01)

HRMT1L3 polyclonal antibody (A01)