TNK2 purified MaxPab rabbit polyclonal antibody (D01P)
  • TNK2 purified MaxPab rabbit polyclonal antibody (D01P)

TNK2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00010188-D01P
TNK2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human TNK2 protein.
Información adicional
Size 100 ug
Gene Name TNK2
Gene Alias ACK|ACK1|FLJ44758|FLJ45547|p21cdc42Hs
Gene Description tyrosine kinase, non-receptor, 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,IF
Immunogen Prot. Seq MQPEEGTGWLLELLSEVQLQQYFLRLRDDLNVTRLSHFEYVKNEDLEKIGMGRPGQRRLWEAVKRRKALCKRKSWMSKVFSGKRLEAEFPPHHSQSTFRKTSPAPGGPAGEGPLQSLTCLIGEKDLRLLEKLGDGSFVVVRRGEWDAPSGKTVSVAVKCLKPDVLSQPEAMDDFIREVNAMHSLDHRNLIRLYGVVLTPPMKMVTELAPLGSLLDRLRKHQGHFLLGTLSRYAVQVAEGMGYLESKRFIHRDLAA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TNK2 (AAH08884.1, 1 a.a. ~ 352 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10188

Enviar un mensaje


TNK2 purified MaxPab rabbit polyclonal antibody (D01P)

TNK2 purified MaxPab rabbit polyclonal antibody (D01P)