ODZ1 polyclonal antibody (A01)
  • ODZ1 polyclonal antibody (A01)

ODZ1 polyclonal antibody (A01)

Ref: AB-H00010178-A01
ODZ1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant ODZ1.
Información adicional
Size 50 uL
Gene Name ODZ1
Gene Alias ODZ3|TEN-M1|TNM|TNM1
Gene Description odz, odd Oz/ten-m homolog 1(Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq TRRFADIQLQHGALCFNIRYGTTVEEEKNHVLEIARQRAVAQAWTKEQRRLQEGEEGIRAWTEGEKQQLLSTGRVQGYDGYFVLSVEQYLELSDSANNIHFMRQSEIGRR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ODZ1 (NP_055068, 2616 a.a. ~ 2725 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10178

Enviar un mensaje


ODZ1 polyclonal antibody (A01)

ODZ1 polyclonal antibody (A01)