ZNF256 monoclonal antibody (M02), clone 2H6
  • ZNF256 monoclonal antibody (M02), clone 2H6

ZNF256 monoclonal antibody (M02), clone 2H6

Ref: AB-H00010172-M02
ZNF256 monoclonal antibody (M02), clone 2H6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ZNF256.
Información adicional
Size 100 ug
Gene Name ZNF256
Gene Alias BMZF-3|BMZF3
Gene Description zinc finger protein 256
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq CNECGKFFSQSSSLIRHRRSHTGERPYECSECWKSFSNHSSLVKHRRVHTGERPYECSECGKSFSQSSNLTNHQRIHSGERPYECSDCGKFFTFNSNLLKHQNVHKG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ZNF256 (NP_005764.2, 521 a.a. ~ 627 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10172
Clone Number 2H6
Iso type IgG2b Kappa

Enviar un mensaje


ZNF256 monoclonal antibody (M02), clone 2H6

ZNF256 monoclonal antibody (M02), clone 2H6