CHST4 polyclonal antibody (A01)
  • CHST4 polyclonal antibody (A01)

CHST4 polyclonal antibody (A01)

Ref: AB-H00010164-A01
CHST4 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CHST4.
Información adicional
Size 50 uL
Gene Name CHST4
Gene Alias LSST
Gene Description carbohydrate (N-acetylglucosamine 6-O) sulfotransferase 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq LMIDSRIVMGQHEQKLKKEDQPYYVMQVICQSQLEIYKTIQSLPKALQERYLLVRYEDLARAPVAQTSRMYEFVGLEFLPHLQTWVHNITRGKGMGDHAF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CHST4 (NP_005760, 221 a.a. ~ 320 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10164

Enviar un mensaje


CHST4 polyclonal antibody (A01)

CHST4 polyclonal antibody (A01)