FARP1 purified MaxPab mouse polyclonal antibody (B01)
  • FARP1 purified MaxPab mouse polyclonal antibody (B01)

FARP1 purified MaxPab mouse polyclonal antibody (B01)

Ref: AB-H00010160-B01P
FARP1 purified MaxPab mouse polyclonal antibody (B01)

Información del producto

Mouse polyclonal antibody raised against a full-length human FARP1 protein.
Información adicional
Size 50 ug
Gene Name FARP1
Gene Alias CDEP|MGC87400|PLEKHC2
Gene Description FERM, RhoGEF (ARHGEF) and pleckstrin domain protein 1 (chondrocyte-derived)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MGEIEQRPTPGSRLGAPENSGISTLERGQKPPPTPSGKLVSIKIQMLDDTQEAFEVPMVSSSSFLKAIGSSWTGWVLRCSMKPKHHSHLIEKFGEDRILTHLTGSISYTNWAGSRSLAVTVTEELLNLF
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen FARP1 (NP_001001715.1, 1 a.a. ~ 129 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10160

Enviar un mensaje


FARP1 purified MaxPab mouse polyclonal antibody (B01)

FARP1 purified MaxPab mouse polyclonal antibody (B01)