TRIM28 monoclonal antibody (M01), clone 4E6 Ver mas grande

TRIM28 monoclonal antibody (M01), clone 4E6

AB-H00010155-M01

Producto nuevo

TRIM28 monoclonal antibody (M01), clone 4E6

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Hoja técnica

Size 100 ug
Gene Name TRIM28
Gene Alias FLJ29029|KAP1|RNF96|TF1B|TIF1B
Gene Description tripartite motif-containing 28
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,IHC-P,ELISA,RNAi-Ab,IF
Immunogen Prot. Seq IVDPVEPHGEMKFQWDLNAWTKSAEAFGKIVAERPGTNSTGPAPMAPPRAPGPLSKQGSGSSQPMEVQEGYGFGSGDDPYSSAEPHVSGVKRSRSGEGEVSGLMRKVPRVSLERLDLDLTADSQPPVFKVFPGSTTEDYNLIVIER
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TRIM28 (AAH04978, 379 a.a. ~ 524 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10155
Clone Number 4E6
Iso type IgG2b Kappa

Más información

Mouse monoclonal antibody raised against a partial recombinant TRIM28.

Consulta sobre un producto

TRIM28 monoclonal antibody (M01), clone 4E6

TRIM28 monoclonal antibody (M01), clone 4E6