PLXNC1 monoclonal antibody (M06), clone 1A12
  • PLXNC1 monoclonal antibody (M06), clone 1A12

PLXNC1 monoclonal antibody (M06), clone 1A12

Ref: AB-H00010154-M06
PLXNC1 monoclonal antibody (M06), clone 1A12

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PLXNC1.
Información adicional
Size 100 ug
Gene Name PLXNC1
Gene Alias CD232|PLXN-C1|VESPR
Gene Description plexin C1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq PYNYTSGAATGWPSMARIAQSTEVLFQGQASLDCGHGHPDGRRLLLSSSLVEALDVWAGVFSAAAGEGQERRSPTTTALCLFRMSEIQARAKRVSWDFK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PLXNC1 (NP_005752, 250 a.a. ~ 348 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10154
Clone Number 1A12
Iso type IgG2b Kappa

Enviar un mensaje


PLXNC1 monoclonal antibody (M06), clone 1A12

PLXNC1 monoclonal antibody (M06), clone 1A12