PLXNC1 polyclonal antibody (A01)
  • PLXNC1 polyclonal antibody (A01)

PLXNC1 polyclonal antibody (A01)

Ref: AB-H00010154-A01
PLXNC1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PLXNC1.
Información adicional
Size 50 uL
Gene Name PLXNC1
Gene Alias CD232|PLXN-C1|VESPR
Gene Description plexin C1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq PYNYTSGAATGWPSMARIAQSTEVLFQGQASLDCGHGHPDGRRLLLSSSLVEALDVWAGVFSAAAGEGQERRSPTTTALCLFRMSEIQARAKRVSWDFK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PLXNC1 (NP_005752, 250 a.a. ~ 348 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10154

Enviar un mensaje


PLXNC1 polyclonal antibody (A01)

PLXNC1 polyclonal antibody (A01)