EBI3 polyclonal antibody (A01)
  • EBI3 polyclonal antibody (A01)

EBI3 polyclonal antibody (A01)

Ref: AB-H00010148-A01
EBI3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant EBI3.
Información adicional
Size 50 uL
Gene Name EBI3
Gene Alias IL27B
Gene Description Epstein-Barr virus induced 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MTPQLLLALVLWASCPPCSGRKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSFIATYRLGMAARGHSWPCLQQTPTSTSCTITDVQLFSMAPYVLNVTAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSFILRAVRPRARYYVQVAAQDLTDYGELSDWSLPATATMSLGK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen EBI3 (AAH15364.1, 1 a.a. ~ 229 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10148

Enviar un mensaje


EBI3 polyclonal antibody (A01)

EBI3 polyclonal antibody (A01)