C4orf6 monoclonal antibody (M01), clone 3F12
  • C4orf6 monoclonal antibody (M01), clone 3F12

C4orf6 monoclonal antibody (M01), clone 3F12

Ref: AB-H00010141-M01
C4orf6 monoclonal antibody (M01), clone 3F12

Información del producto

Mouse monoclonal antibody raised against a partial recombinant C4orf6.
Información adicional
Size 100 ug
Gene Name C4orf6
Gene Alias aC1
Gene Description chromosome 4 open reading frame 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq MDTQKQIHKTHNSKNQFFTIFFFLSVEFGKEGTRKNFYLLLSIGHYGRKSRRADLGTADTADKTEPECFAASWTFDPNPSVTVSGAHSTAVHQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen C4orf6 (NP_005741, 1 a.a. ~ 93 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10141
Clone Number 3F12
Iso type IgG2b Kappa

Enviar un mensaje


C4orf6 monoclonal antibody (M01), clone 3F12

C4orf6 monoclonal antibody (M01), clone 3F12