ELA3A purified MaxPab mouse polyclonal antibody (B01P)
  • ELA3A purified MaxPab mouse polyclonal antibody (B01P)

ELA3A purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00010136-B01P
ELA3A purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ELA3A protein.
Información adicional
Size 50 ug
Gene Name ELA3A
Gene Alias ELA3
Gene Description elastase 3A, pancreatic
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MMLRLLSSLLLVAVASGYGPPSSHSSSRVVHGEDAVPYSWPWQVSLQYEKSGSFYHTCGGSLIAPDWVVTAGHCISRDLTYQVVLGEYNLAVKEGPEQVIPINSEELFVHPLWNRSCVACGNDIALIKLSRSAQLGDAVQLASLPPAGDILPNKTPCYITGWGRLYTNGPLPDKLQQARLPVVDYKHCSRWNWWGSTVKKTMVCAGGYIRSGCNGDSGGPLNCPTEDGGWQVHGVTSFVSGFGCNFIWKPTVFTR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ELA3A (NP_005738.3, 1 a.a. ~ 270 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10136

Enviar un mensaje


ELA3A purified MaxPab mouse polyclonal antibody (B01P)

ELA3A purified MaxPab mouse polyclonal antibody (B01P)