TRAP1 MaxPab mouse polyclonal antibody (B01)
  • TRAP1 MaxPab mouse polyclonal antibody (B01)

TRAP1 MaxPab mouse polyclonal antibody (B01)

Ref: AB-H00010131-B01
TRAP1 MaxPab mouse polyclonal antibody (B01)

Información del producto

Mouse polyclonal antibody raised against a full-length human TRAP1 protein.
Información adicional
Size 50 uL
Gene Name TRAP1
Gene Alias HSP75|HSP90L
Gene Description TNF receptor-associated protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IF
Immunogen Prot. Seq MARELRALLLWGRRLRPLLRAPALAAVPGGKPILCPRRTTAQLGPRRNPAWSLQAGRLFSTQTAEDKEEPLHSIISSTESVQGSTSKHEFQAETKKLLDIVARSLYSEKEVFIRELISNASDALEKLRHKLVSDGQALPEMEIHLQTNAEKGTITIQDTGIGMTQEELVSNLGTIARSGSKAFLDALQNQAEASSKIIGQFGVGFYSAFMVADRVEVYSRSAAPGSLGYQWLSDGSGVFEIAEASGVRTGTKIII
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TRAP1 (NP_057376.1, 1 a.a. ~ 704 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 10131

Enviar un mensaje


TRAP1 MaxPab mouse polyclonal antibody (B01)

TRAP1 MaxPab mouse polyclonal antibody (B01)