Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Antibody
ACTR1A monoclonal antibody (M08), clone 3E5
Abnova
ACTR1A monoclonal antibody (M08), clone 3E5
Ref: AB-H00010121-M08
ACTR1A monoclonal antibody (M08), clone 3E5
Contáctenos
Información del producto
Mouse monoclonal antibody raised against a partial recombinant ACTR1A.
Información adicional
Size
100 ug
Gene Name
ACTR1A
Gene Alias
ARP1|CTRN1|FLJ52695|FLJ52800|FLJ55002
Gene Description
ARP1 actin-related protein 1 homolog A, centractin alpha (yeast)
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
S-ELISA,ELISA
Immunogen Prot. Seq
LVFAIQKSDMDLRRTLFSNIVLSGGSTLFKGFGDRLLSEVKKLAPKDVKIRISAPQERLYSTWIGGSILASLDTFKKMWVSKKEYEEDGARSIHRKT
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
ACTR1A (NP_005727, 279 a.a. ~ 375 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
10121
Clone Number
3E5
Iso type
IgG2a Kappa
Enviar un mensaje
ACTR1A monoclonal antibody (M08), clone 3E5
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*