SGK2 monoclonal antibody (M08), clone 7C7
  • SGK2 monoclonal antibody (M08), clone 7C7

SGK2 monoclonal antibody (M08), clone 7C7

Ref: AB-H00010110-M08
SGK2 monoclonal antibody (M08), clone 7C7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SGK2.
Información adicional
Size 100 ug
Gene Name SGK2
Gene Alias H-SGK2|dJ138B7.2
Gene Description serum/glucocorticoid regulated kinase 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq SPINWDDLYHKRLTPPFNPNVTGPADLKHFDPEFTQEAVSKSIGCTPDTVASSSGASSAFLGFSYAPEDDDILDC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SGK2 (AAH65511, 293 a.a. ~ 367 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10110
Clone Number 7C7
Iso type IgG1 Kappa

Enviar un mensaje


SGK2 monoclonal antibody (M08), clone 7C7

SGK2 monoclonal antibody (M08), clone 7C7