SGK2 MaxPab rabbit polyclonal antibody (D01)
  • SGK2 MaxPab rabbit polyclonal antibody (D01)

SGK2 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00010110-D01
SGK2 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human SGK2 protein.
Información adicional
Size 100 uL
Gene Name SGK2
Gene Alias H-SGK2|dJ138B7.2
Gene Description serum/glucocorticoid regulated kinase 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IP
Immunogen Prot. Seq MNSSPAGTPSPQPSRANGNINLGPSANPNAQPTDFDFLKVIGKGNYGKVLLAKRKSDGAFYAVKVLQKKSILKKKEQSHIMAERSVLLKNVRHPFLVGLRYSFQTPEKLYFVLDYVNGGELFFHLQRERRFLEPRARFYAAEVASAIGYLHSLNIIYRDLKPENILLDCQGHVVLTDFGLCKEGVEPEDTTSTFCGTPEYLAPEVLRKEPYDRAVDWWCLGAVLYEMLHGLPPFYSQDVSQMYENILHQPLQIPG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SGK2 (NP_733794.1, 1 a.a. ~ 367 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 10110

Enviar un mensaje


SGK2 MaxPab rabbit polyclonal antibody (D01)

SGK2 MaxPab rabbit polyclonal antibody (D01)