CTDSP2 monoclonal antibody (M02), clone 3F11
  • CTDSP2 monoclonal antibody (M02), clone 3F11

CTDSP2 monoclonal antibody (M02), clone 3F11

Ref: AB-H00010106-M02
CTDSP2 monoclonal antibody (M02), clone 3F11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CTDSP2.
Información adicional
Size 100 ug
Gene Name CTDSP2
Gene Alias OS4|PSR2|SCP2
Gene Description CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq MEHGSIITQARREDALVLTKQGLVSKSSPKKPRGRNIFKALFCCFRAQHVGQSSSSTELAAYKEEANTIAKSDLLQCLQYQFYQIPGTCLLPEVTEEDQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CTDSP2 (NP_005721, 1 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10106
Clone Number 3F11
Iso type IgG2b Kappa

Enviar un mensaje


CTDSP2 monoclonal antibody (M02), clone 3F11

CTDSP2 monoclonal antibody (M02), clone 3F11