PPIF polyclonal antibody (A01)
  • PPIF polyclonal antibody (A01)

PPIF polyclonal antibody (A01)

Ref: AB-H00010105-A01
PPIF polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PPIF.
Información adicional
Size 50 uL
Gene Name PPIF
Gene Alias CYP3|Cyp-D|FLJ90798|MGC117207
Gene Description peptidylprolyl isomerase F
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq IYGSRFPDENFTLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVKEGMDVVKKIESFGSKSGRTSKKIVITDCGQLS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PPIF (NP_005720, 120 a.a. ~ 207 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10105

Enviar un mensaje


PPIF polyclonal antibody (A01)

PPIF polyclonal antibody (A01)