TSPAN2 polyclonal antibody (A01)
  • TSPAN2 polyclonal antibody (A01)

TSPAN2 polyclonal antibody (A01)

Ref: AB-H00010100-A01
TSPAN2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant TSPAN2.
Información adicional
Size 50 uL
Gene Name TSPAN2
Gene Alias 6330415F13Rik|FLJ12082|TSN2|TSPAN-2
Gene Description tetraspanin 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq GKGVAIRHVQTMYEEAYNDYLKDRGKGNGTLITFHSTFQCCGKESSEQVQPTCPKELLGHKNCIDEIETIISVKLQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TSPAN2 (NP_005716, 112 a.a. ~ 187 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10100

Enviar un mensaje


TSPAN2 polyclonal antibody (A01)

TSPAN2 polyclonal antibody (A01)