ARPC5 monoclonal antibody (M02), clone 2D10
  • ARPC5 monoclonal antibody (M02), clone 2D10

ARPC5 monoclonal antibody (M02), clone 2D10

Ref: AB-H00010092-M02
ARPC5 monoclonal antibody (M02), clone 2D10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ARPC5.
Información adicional
Size 100 ug
Gene Name ARPC5
Gene Alias ARC16|MGC88523|dJ127C7.3|p16-Arc
Gene Description actin related protein 2/3 complex, subunit 5, 16kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq KNTVSSARFRKVDVDEYDENKFVDEEDGGDGQAGPDEGEVDSCLRQGNMTAALQAALKNPPINTKSQAVKDRAGSIVLKVLISFKANDIEKA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ARPC5 (NP_005708.1, 3 a.a. ~ 94 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10092
Clone Number 2D10
Iso type IgG2a Kappa

Enviar un mensaje


ARPC5 monoclonal antibody (M02), clone 2D10

ARPC5 monoclonal antibody (M02), clone 2D10