PDCD7 monoclonal antibody (M01), clone 3H5
  • PDCD7 monoclonal antibody (M01), clone 3H5

PDCD7 monoclonal antibody (M01), clone 3H5

Ref: AB-H00010081-M01
PDCD7 monoclonal antibody (M01), clone 3H5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PDCD7.
Información adicional
Size 100 ug
Gene Name PDCD7
Gene Alias ES18|HES18|MGC22015
Gene Description programmed cell death 7
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq KRELEKKQRKEKEKILLQKREIESKLFGDPDEFPLAHLLEPFRQYYLQAEHSLPALIQIRHDWDQYLVPSDHPKGNFVPQGWVLPPLPSNDIWATAVKLH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PDCD7 (AAH16992, 47 a.a. ~ 146 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10081
Clone Number 3H5
Iso type IgG2a Kappa

Enviar un mensaje


PDCD7 monoclonal antibody (M01), clone 3H5

PDCD7 monoclonal antibody (M01), clone 3H5