TSPAN32 monoclonal antibody (M04), clone 2G12 Ver mas grande

TSPAN32 monoclonal antibody (M04), clone 2G12

AB-H00010077-M04

Producto nuevo

TSPAN32 monoclonal antibody (M04), clone 2G12

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Hoja técnica

Size 100 ug
Gene Name TSPAN32
Gene Alias FLJ17158|FLJ97586|MGC22455|PHEMX|PHMX|TSSC6
Gene Description tetraspanin 32
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq RCGCSLDRKGKYTLTPRACGRQPQEPSLLRCSQGGPTHCLHSEAVAIGPRGCSGSLRWLQESDAAPLPLSCHLAAHRALQGRSRGGLSGCPERGLSD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TSPAN32 (NP_005696, 194 a.a. ~ 290 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10077
Clone Number 2G12
Iso type IgG1 Kappa

Más información

Mouse monoclonal antibody raised against a partial recombinant TSPAN32.

Consulta sobre un producto

TSPAN32 monoclonal antibody (M04), clone 2G12

TSPAN32 monoclonal antibody (M04), clone 2G12