DPP3 monoclonal antibody (M01A), clone 4D3
  • DPP3 monoclonal antibody (M01A), clone 4D3

DPP3 monoclonal antibody (M01A), clone 4D3

Ref: AB-H00010072-M01A
DPP3 monoclonal antibody (M01A), clone 4D3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant DPP3.
Información adicional
Size 200 uL
Gene Name DPP3
Gene Alias DPPIII|FLJ11387|FLJ22331
Gene Description dipeptidyl-peptidase 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq LTFLEEDDKDLYILWKGPSFDVQVGLHELLGHGSGKLFVQDEKGAFNFDQETVINPETGEQIQSWYRSGETWDSKFSTIAS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DPP3 (NP_005691.2, 424 a.a. ~ 504 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 10072
Clone Number 4D3
Iso type IgM Kappa

Enviar un mensaje


DPP3 monoclonal antibody (M01A), clone 4D3

DPP3 monoclonal antibody (M01A), clone 4D3