MUC12 monoclonal antibody (M01), clone 8B10
  • MUC12 monoclonal antibody (M01), clone 8B10

MUC12 monoclonal antibody (M01), clone 8B10

Ref: AB-H00010071-M01
MUC12 monoclonal antibody (M01), clone 8B10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant MUC12.
Información adicional
Size 100 ug
Gene Name MUC12
Gene Alias MUC11
Gene Description mucin 12, cell surface associated
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq GGNTTSASTPSSSDPFTTFSDYGVSVTFITGSTATKHFLDSSTNSGHSEESTVSHSGPGATGTTLFPSHSATSVFVGEPKTSPITSASME
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MUC12 (XP_499350.1, 31 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10071
Clone Number 8B10
Iso type IgG2a Kappa

Enviar un mensaje


MUC12 monoclonal antibody (M01), clone 8B10

MUC12 monoclonal antibody (M01), clone 8B10