IL18BP monoclonal antibody (M05), clone 2A9
  • IL18BP monoclonal antibody (M05), clone 2A9

IL18BP monoclonal antibody (M05), clone 2A9

Ref: AB-H00010068-M05
IL18BP monoclonal antibody (M05), clone 2A9

Información del producto

Mouse monoclonal antibody raised against a full length recombinant IL18BP.
Información adicional
Size 100 ug
Gene Name IL18BP
Gene Alias IL18BPa
Gene Description interleukin 18 binding protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq TPVSQTTTAATASVRSTKDPCPSQPPVFPAAKQCPALEVTWPEVEVPLNGTLSLSCVACSRFPNFSILYWLGNGSFIEHLPGRLWEGSTSRERGSTGTQLCKALVLEQLTPALHSTNFSCVLVDPEQVVQRHVVLAQLWAGLRATLPPTQEALPSSHSSPQQQG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen IL18BP (AAH44215, 31 a.a. ~ 194 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10068
Clone Number 2A9
Iso type IgG2b Kappa

Enviar un mensaje


IL18BP monoclonal antibody (M05), clone 2A9

IL18BP monoclonal antibody (M05), clone 2A9