COX17 polyclonal antibody (A01)
  • COX17 polyclonal antibody (A01)

COX17 polyclonal antibody (A01)

Ref: AB-H00010063-A01
COX17 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant COX17.
Información adicional
Size 50 uL
Gene Name COX17
Gene Alias MGC104397|MGC117386
Gene Description COX17 cytochrome c oxidase assembly homolog (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MPGLVDSNPAPPESQEKKPLKPCCACPETKKARDACIIEKGEEHCGHLIEAHKECMRALGFKI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen COX17 (NP_005685, 1 a.a. ~ 63 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10063

Enviar un mensaje


COX17 polyclonal antibody (A01)

COX17 polyclonal antibody (A01)