SMC4L1 polyclonal antibody (A01)
  • SMC4L1 polyclonal antibody (A01)

SMC4L1 polyclonal antibody (A01)

Ref: AB-H00010051-A01
SMC4L1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SMC4L1.
Información adicional
Size 50 uL
Gene Name SMC4
Gene Alias CAPC|SMC4L1|hCAP-C
Gene Description structural maintenance of chromosomes 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq DSIDIAQECVNFLKRQNIGVATFIGLDKMAVWAKKMTEIQTPENTPRLFDLVKVKDEKIRQAFYFALRDTLVADNLDQATRVAYQKDRRWRVVTLQGQIIEQSGTMTGGG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SMC4L1 (NP_005487, 646 a.a. ~ 755 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10051

Enviar un mensaje


SMC4L1 polyclonal antibody (A01)

SMC4L1 polyclonal antibody (A01)