SLC17A4 monoclonal antibody (M03), clone 3E4
  • SLC17A4 monoclonal antibody (M03), clone 3E4

SLC17A4 monoclonal antibody (M03), clone 3E4

Ref: AB-H00010050-M03
SLC17A4 monoclonal antibody (M03), clone 3E4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SLC17A4.
Información adicional
Size 100 ug
Gene Name SLC17A4
Gene Alias KAIA2138|KIAA2138|MGC129623
Gene Description solute carrier family 17 (sodium phosphate), member 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq NLSIAIPAMVNNTAPPSQPNASTERPSTDSQGYWNETLKEFKAMAPAYDWSPEIQGIILSSLNYGSFLAPIPSGYV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SLC17A4 (NP_005486.1, 56 a.a. ~ 131 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10050
Clone Number 3E4
Iso type IgG1 Kappa

Enviar un mensaje


SLC17A4 monoclonal antibody (M03), clone 3E4

SLC17A4 monoclonal antibody (M03), clone 3E4