CXorf6 polyclonal antibody (A01)
  • CXorf6 polyclonal antibody (A01)

CXorf6 polyclonal antibody (A01)

Ref: AB-H00010046-A01
CXorf6 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CXorf6.
Información adicional
Size 50 uL
Gene Name MAMLD1
Gene Alias CG1|CXorf6|F18
Gene Description mastermind-like domain containing 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq SPSNITHVDKACKLGEARHPQVSLGRQPPSCQALGSESFLPGSSFAHELARVTSSYSTSEAAPWGSWDPKAWRQVPAPLLPSCDATARGTEIRSYGNDP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CXorf6 (NP_005482, 603 a.a. ~ 701 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10046

Enviar un mensaje


CXorf6 polyclonal antibody (A01)

CXorf6 polyclonal antibody (A01)