SH2D3C monoclonal antibody (M06), clone 3F5
  • SH2D3C monoclonal antibody (M06), clone 3F5

SH2D3C monoclonal antibody (M06), clone 3F5

Ref: AB-H00010044-M06
SH2D3C monoclonal antibody (M06), clone 3F5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SH2D3C.
Información adicional
Size 100 ug
Gene Name SH2D3C
Gene Alias CHAT|FLJ39664|NSP3|PRO34088
Gene Description SH2 domain containing 3C
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MTAVGRRCPALGSRGAAGEPEAGSDYVKFSKEKYILDSSPEKLHKELEEELKLSSTDLRSHAWYHGRIPREVSETLVQRNGDFLIRDSLTSLGDYVLTCRWRNQALHFKI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SH2D3C (NP_005480, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10044
Clone Number 3F5
Iso type IgG1 kappa

Enviar un mensaje


SH2D3C monoclonal antibody (M06), clone 3F5

SH2D3C monoclonal antibody (M06), clone 3F5