TOM1 monoclonal antibody (M06), clone 1C5
  • TOM1 monoclonal antibody (M06), clone 1C5

TOM1 monoclonal antibody (M06), clone 1C5

Ref: AB-H00010043-M06
TOM1 monoclonal antibody (M06), clone 1C5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TOM1.
Información adicional
Size 100 ug
Gene Name TOM1
Gene Alias FLJ33404
Gene Description target of myb1 (chicken)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq GLAGALDARQQSTGAIPVTQACLMEDIEQWLSTDVGNDAEEPKGVTSEEFDKFLEERAKAADRLPNLSSPSAEGPPGPPSGPAPRKKTQEKDDDMLFA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TOM1 (NP_005479, 394 a.a. ~ 491 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10043
Clone Number 1C5
Iso type IgG1 Kappa

Enviar un mensaje


TOM1 monoclonal antibody (M06), clone 1C5

TOM1 monoclonal antibody (M06), clone 1C5