TOM1 polyclonal antibody (A01)
  • TOM1 polyclonal antibody (A01)

TOM1 polyclonal antibody (A01)

Ref: AB-H00010043-A01
TOM1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant TOM1.
Información adicional
Size 50 uL
Gene Name TOM1
Gene Alias FLJ33404
Gene Description target of myb1 (chicken)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq GLAGALDARQQSTGAIPVTQACLMEDIEQWLSTDVGNDAEEPKGVTSEEFDKFLEERAKAADRLPNLSSPSAEGPPGPPSGPAPRKKTQEKDDDMLFA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TOM1 (NP_005479, 394 a.a. ~ 491 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10043

Enviar un mensaje


TOM1 polyclonal antibody (A01)

TOM1 polyclonal antibody (A01)