HMG2L1 polyclonal antibody (A01)
  • HMG2L1 polyclonal antibody (A01)

HMG2L1 polyclonal antibody (A01)

Ref: AB-H00010042-A01
HMG2L1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant HMG2L1.
Información adicional
Size 50 uL
Gene Name HMGXB4
Gene Alias HMG2L1|HMGBCG|THC211630
Gene Description HMG box domain containing 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MAYDDSVKKEDCFDGDHTFEDIGLAAGRSQREKKRSYKDFLREEEEIAAQVRNSSKKKLKDSELYFLGTDTHKK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HMG2L1 (NP_001003681, 1 a.a. ~ 74 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10042

Enviar un mensaje


HMG2L1 polyclonal antibody (A01)

HMG2L1 polyclonal antibody (A01)