TROAP polyclonal antibody (A01)
  • TROAP polyclonal antibody (A01)

TROAP polyclonal antibody (A01)

Ref: AB-H00010024-A01
TROAP polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant TROAP.
Información adicional
Size 50 uL
Gene Name TROAP
Gene Alias TASTIN
Gene Description trophinin associated protein (tastin)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq RLDPARASCFSRLEGPGPRGRTLCPQRLQALISPSGPSFHPSTHPSFQELRRETAGSSRTSVSQASGLLLETPVQPAFSLPKGEREVVTHSDEGGVASLG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TROAP (NP_005471, 181 a.a. ~ 280 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10024

Enviar un mensaje


TROAP polyclonal antibody (A01)

TROAP polyclonal antibody (A01)