NR2E3 monoclonal antibody (M01), clone 2A12
  • NR2E3 monoclonal antibody (M01), clone 2A12

NR2E3 monoclonal antibody (M01), clone 2A12

Ref: AB-H00010002-M01
NR2E3 monoclonal antibody (M01), clone 2A12

Información del producto

Mouse monoclonal antibody raised against a full length recombinant NR2E3.
Información adicional
Size 100 ug
Gene Name NR2E3
Gene Alias ESCS|MGC49976|PNR|RNR|RP37|rd7
Gene Description nuclear receptor subfamily 2, group E, member 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MCPVDKAHRNQCQACRLKKCLQAGMNQDAVQNERQPRSTAQVHLDSMESNTESRPESLVAPPAPAGRSPRGPTPMSAARALGHHFMASLITAETCAKLEPEDADENIDVTSNDPEFPSSPYSSSSPCGLDSIHETSARLLFMAVKWAKNLPVFSSLPFRDQVILLEEAWSELFLLGAIQWSLPLDSCPLLAPPEASAAGGAQGRLTLASMETRVLQETISRFRALAVDPTEFACMKALVLFKPETRGLKDPEHVE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NR2E3 (AAH41421, 1 a.a. ~ 322 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10002
Clone Number 2A12
Iso type IgG1

Enviar un mensaje


NR2E3 monoclonal antibody (M01), clone 2A12

NR2E3 monoclonal antibody (M01), clone 2A12