NR2E3 purified MaxPab mouse polyclonal antibody (B01P)
  • NR2E3 purified MaxPab mouse polyclonal antibody (B01P)

NR2E3 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00010002-B01P
NR2E3 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human NR2E3 protein.
Información adicional
Size 50 ug
Gene Name NR2E3
Gene Alias ESCS|MGC49976|PNR|RNR|RP37|rd7
Gene Description nuclear receptor subfamily 2, group E, member 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq METRPTALMSSTVAAAAPAAGAASRKESPGRWGLGEDPTGVSPSLQCRVCGDSSSGKHYGIYACNGCSGFFKRSVRRRLIYRCQVGAGMCPVDKAHRNQCQACRLKKCLQAGMNQDAVQNERQPRSTAQVHLDSMESNTESRPESLVAPPAPAGRSPRGPTPMSAARALGHHFMASLITAETCAKLEPEDADENIDVTSNDPEFPSSPYSSSSPCGLDSIHETSARLLFMAVKWAKNLPVFSSLPFRDQVILLEE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NR2E3 (NP_055064.1, 1 a.a. ~ 410 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10002

Enviar un mensaje


NR2E3 purified MaxPab mouse polyclonal antibody (B01P)

NR2E3 purified MaxPab mouse polyclonal antibody (B01P)