ROD1 polyclonal antibody (A01)
  • ROD1 polyclonal antibody (A01)

ROD1 polyclonal antibody (A01)

Ref: AB-H00009991-A01
ROD1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant ROD1.
Información adicional
Size 50 uL
Gene Name ROD1
Gene Alias DKFZp781I1117|PTBP3
Gene Description ROD1 regulator of differentiation 1 (S. pombe)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq GSDELLSSGIINGPFTMNSSTPSTANGNDSKKFKRDRPPCSPSRVLHLRKIPCDVTEAEIISLGLPFGKVTNLLMLKGKSQAFLEMASEEAAVTMVNYY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ROD1 (NP_005147, 16 a.a. ~ 114 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 9991

Enviar un mensaje


ROD1 polyclonal antibody (A01)

ROD1 polyclonal antibody (A01)