SLC12A6 polyclonal antibody (A01)
  • SLC12A6 polyclonal antibody (A01)

SLC12A6 polyclonal antibody (A01)

Ref: AB-H00009990-A01
SLC12A6 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SLC12A6.
Información adicional
Size 50 uL
Gene Name SLC12A6
Gene Alias ACCPN|DKFZp434D2135|KCC3|KCC3A|KCC3B
Gene Description solute carrier family 12 (potassium/chloride transporters), member 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MPHFTVTKVEDPEEGAAASISQEPSLADIKARIQDSDEPDLSQNSITGEHSQLLDDGHKKARNAYLNNSNYEEGDEYFDKNLALFEEEMD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SLC12A6 (NP_005126, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 9990

Enviar un mensaje


SLC12A6 polyclonal antibody (A01)

SLC12A6 polyclonal antibody (A01)