DMTF1 polyclonal antibody (A01)
  • DMTF1 polyclonal antibody (A01)

DMTF1 polyclonal antibody (A01)

Ref: AB-H00009988-A01
DMTF1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant DMTF1.
Información adicional
Size 50 uL
Gene Name DMTF1
Gene Alias DMP1|DMTF|FLJ25188|FLJ41265|FLJ76054|hDMP1
Gene Description cyclin D binding myb-like transcription factor 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq KQEESPSDLASAYVTEGLESPTIEEQVDQTIDDETILIVPSPHGFIQASDVIDTESVLPLTTLTDPILQHHQEESNIIGSSLGSPVSEDSKDVEDLVNCH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DMTF1 (NP_066968, 661 a.a. ~ 760 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 9988

Enviar un mensaje


DMTF1 polyclonal antibody (A01)

DMTF1 polyclonal antibody (A01)