RCE1 monoclonal antibody (M06), clone 6A6
  • RCE1 monoclonal antibody (M06), clone 6A6

RCE1 monoclonal antibody (M06), clone 6A6

Ref: AB-H00009986-M06
RCE1 monoclonal antibody (M06), clone 6A6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RCE1.
Información adicional
Size 100 ug
Gene Name RCE1
Gene Alias FACE2|RCE1A|RCE1B
Gene Description RCE1 homolog, prenyl protein peptidase (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq QLSMDCPCDLADGLKVVLAPRSWARCLTDMRWLRNQVIAPLTEELVFRAC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RCE1 (NP_005124, 133 a.a. ~ 182 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9986
Clone Number 6A6
Iso type IgG2a Kappa

Enviar un mensaje


RCE1 monoclonal antibody (M06), clone 6A6

RCE1 monoclonal antibody (M06), clone 6A6