RBX1 polyclonal antibody (A01)
  • RBX1 polyclonal antibody (A01)

RBX1 polyclonal antibody (A01)

Ref: AB-H00009978-A01
RBX1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant RBX1.
Información adicional
Size 50 uL
Gene Name RBX1
Gene Alias BA554C12.1|MGC13357|MGC1481|RNF75|ROC1
Gene Description ring-box 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RBX1 (AAH01466, 1 a.a. ~ 108 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 9978

Enviar un mensaje


RBX1 polyclonal antibody (A01)

RBX1 polyclonal antibody (A01)