CLEC2B polyclonal antibody (A01)
  • CLEC2B polyclonal antibody (A01)

CLEC2B polyclonal antibody (A01)

Ref: AB-H00009976-A01
CLEC2B polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CLEC2B.
Información adicional
Size 50 uL
Gene Name CLEC2B
Gene Alias AICL|CLECSF2|HP10085|IFNRG1
Gene Description C-type lectin domain family 2, member B
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq EEGDWNSSKYNCSTQHADLTIIDNIEEMNFLRRYKCSSDHWIGLKMAKNRTGQWVDGATFTKSFGMRGSEGCAYLSDDGAATARCYTERKWICRKRIH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CLEC2B (NP_005118, 52 a.a. ~ 149 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 9976

Enviar un mensaje


CLEC2B polyclonal antibody (A01)

CLEC2B polyclonal antibody (A01)