NR1D2 purified MaxPab rabbit polyclonal antibody (D01P)
  • NR1D2 purified MaxPab rabbit polyclonal antibody (D01P)

NR1D2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00009975-D01P
NR1D2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human NR1D2 protein.
Información adicional
Size 100 ug
Gene Name NR1D2
Gene Alias BD73|EAR-1r|HZF2|Hs.37288|RVR
Gene Description nuclear receptor subfamily 1, group D, member 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr
Immunogen Prot. Seq MEVNAGGVIAYISSSSSASSHASCHSEGSENSFQSSSSSVPSSPNSSNSDTNGNPKNGDLANIEGILKNDRIDCSMKTSKSSAPGMTKSHSGVTKFSGMVLLCKVCGDVASGFHYGVHACEGCKGFFRRSIQQNIQYKKCLKNENCSIMRMNRNRCQQCRFKKCLSVGMSRDAVRFGRIPKREKQRMLIEMQSAMKTMMNSQFSGHLQNDTLVEHHEQTALPAQEQLRPKPQLEQENIKSSSPPSSDFAKEEVIG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NR1D2 (NP_005117.2, 1 a.a. ~ 579 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9975

Enviar un mensaje


NR1D2 purified MaxPab rabbit polyclonal antibody (D01P)

NR1D2 purified MaxPab rabbit polyclonal antibody (D01P)