CCS purified MaxPab rabbit polyclonal antibody (D01P)
  • CCS purified MaxPab rabbit polyclonal antibody (D01P)

CCS purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00009973-D01P
CCS purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CCS protein.
Información adicional
Size 100 ug
Gene Name CCS
Gene Alias MGC138260
Gene Description copper chaperone for superoxide dismutase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MASDSGNQGTLCTLEFAVQMTCQSCVDAVRKSLQGVAGVQDVEVHLEDQMVLVHTTLPSQEVQALLEGTGRQAVLKGMGSGQLQNLGAAVAILGGPGTVQGVVRFLQLTPERCLIEGTIDGLEPGLHGLHVHQYGDLTNNCNSCGNHFNPDGASHGGPQDSDRHRGDLGNVRADADGRAIFRMEDEQLKVWDVIGRSLIIDEGEDDLGRGGHPLSKITGNSGERLACGIIARSAGLFQNPKQICSCDGLTIWEER
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CCS (NP_005116.1, 1 a.a. ~ 274 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9973

Enviar un mensaje


CCS purified MaxPab rabbit polyclonal antibody (D01P)

CCS purified MaxPab rabbit polyclonal antibody (D01P)