CCS MaxPab rabbit polyclonal antibody (D01)
  • CCS MaxPab rabbit polyclonal antibody (D01)

CCS MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00009973-D01
CCS MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CCS protein.
Información adicional
Size 100 uL
Gene Name CCS
Gene Alias MGC138260
Gene Description copper chaperone for superoxide dismutase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MASDSGNQGTLCTLEFAVQMTCQSCVDAVRKSLQGVAGVQDVEVHLEDQMVLVHTTLPSQEVQALLEGTGRQAVLKGMGSGQLQNLGAAVAILGGPGTVQGVVRFLQLTPERCLIEGTIDGLEPGLHGLHVHQYGDLTNNCNSCGNHFNPDGASHGGPQDSDRHRGDLGNVRADADGRAIFRMEDEQLKVWDVIGRSLIIDEGEDDLGRGGHPLSKITGNSGERLACGIIARSAGLFQNPKQICSCDGLTIWEER
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CCS (NP_005116.1, 1 a.a. ~ 274 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 9973

Enviar un mensaje


CCS MaxPab rabbit polyclonal antibody (D01)

CCS MaxPab rabbit polyclonal antibody (D01)