USP3 monoclonal antibody (M01), clone 1H2
  • USP3 monoclonal antibody (M01), clone 1H2

USP3 monoclonal antibody (M01), clone 1H2

Ref: AB-H00009960-M01
USP3 monoclonal antibody (M01), clone 1H2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant USP3.
Información adicional
Size 100 ug
Gene Name USP3
Gene Alias MGC129878|MGC129879|SIH003|UBP
Gene Description ubiquitin specific peptidase 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq RNKVDTYVEFPLRGLDMKCYLLEPENSGPESCLYDLAAVVVHHGSGVGSGHYTAYATHEGRWFHFNDSTVTLTDEETVVKAKAYILFYVEHQAKAGSDKL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen USP3 (NP_006528, 421 a.a. ~ 520 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9960
Clone Number 1H2
Iso type IgG2a Kappa

Enviar un mensaje


USP3 monoclonal antibody (M01), clone 1H2

USP3 monoclonal antibody (M01), clone 1H2