USP3 MaxPab rabbit polyclonal antibody (D01)
  • USP3 MaxPab rabbit polyclonal antibody (D01)

USP3 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00009960-D01
USP3 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human USP3 protein.
Información adicional
Size 100 uL
Gene Name USP3
Gene Alias MGC129878|MGC129879|SIH003|UBP
Gene Description ubiquitin specific peptidase 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MECPHLSSSVCIAPDSAKFPNGSPSSWCCSVCRSNKSPWVCLTCSSVHCGRYVNGHAKKHYEDAQVPLTNHKKSEKQDKVQHTVCMDCSSYSTYCYRCDDFVVNDTKLGLVQKVREHLQNLENSAFTADRHKKRKLLENSTLNSKLLKVNGSTTAICATGLRNLGNTCFMNAILQSLSNIEQFCCYFKELPAVELRNGKTAGRRTYHTRSQGDNNVSLVEEFRKTLCALWQGSQTAFSPESLFYVVWKIMPNFRG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen USP3 (NP_006528.2, 1 a.a. ~ 520 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 9960

Enviar un mensaje


USP3 MaxPab rabbit polyclonal antibody (D01)

USP3 MaxPab rabbit polyclonal antibody (D01)