OXSR1 monoclonal antibody (M08), clone 1F6
  • OXSR1 monoclonal antibody (M08), clone 1F6

OXSR1 monoclonal antibody (M08), clone 1F6

Ref: AB-H00009943-M08
OXSR1 monoclonal antibody (M08), clone 1F6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant OXSR1.
Información adicional
Size 100 ug
Gene Name OXSR1
Gene Alias KIAA1101|OSR1
Gene Description oxidative-stress responsive 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,IP,ELISA,IF
Immunogen Prot. Seq KAAISQLRSPRVKESISNSELFPTTDPVGTLLQVPEQISAHLPQPAGQIATQPTQVSLPPTAEPAKTAQALSSGSGSQETKIPISLVLRLRNSKKELNDI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen OXSR1 (AAH08726.1, 351 a.a. ~ 450 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9943
Clone Number 1F6
Iso type IgG2a Kappa

Enviar un mensaje


OXSR1 monoclonal antibody (M08), clone 1F6

OXSR1 monoclonal antibody (M08), clone 1F6